Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
$0.00
Accessories

Cheeky little trinkets and charms to add that special little cherry on top to all of your outfits!

Accessories
All tied up (chocolate)
All tied up (chocolate)
$2.00
All Tied Up (Vanilla)
All Tied Up (Vanilla)
$2.00
Eat My Ass Pin
Eat My Ass Pin
$2.00
Hottie With A Tummy-ache Pin
Hottie With A Tummy-ache Pin
$2.00
I Eat Mysogynists Pin
I Eat Mysogynists Pin
$2.00
I Eat Transphobes Pin
I Eat Transphobes Pin
$2.00
Menu Select Pin (Blue)
Menu Select Pin (Blue)
$2.00
Menu Select Pin (Pink)
Menu Select Pin (Pink)
$2.00
Pretty Rave Boy Pin
Pretty Rave Boy Pin
$2.00
Pretty Rave Girl Pin
Pretty Rave Girl Pin
$2.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract